PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_A03AB7608.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 133aa    MW: 15304.5 Da    PI: 10.2493
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_A03AB7608.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.93.1e-20754148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  Traes_2DL_A03AB7608.1  7 RGQWTPEEDNKLLSYITQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 54
                           89********************************************97 PP

2Myb_DNA-binding45.12.4e-1461103246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g +T  E++ +++++   G + W+ Ia+ ++ gRt++++k++w++
  Traes_2DL_A03AB7608.1  61 GEFTDAEEQTIIKLHSVVGCR-WSVIAAQLP-GRTDNDVKNHWNT 103
                            78*****************99.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.91258IPR017930Myb domain
SuperFamilySSF466891.1E-294101IPR009057Homeodomain-like
SMARTSM007174.0E-14656IPR001005SANT/Myb domain
PfamPF002495.5E-18754IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-26861IPR009057Homeodomain-like
CDDcd001675.84E-121054No hitNo description
SMARTSM007172.5E-1359107IPR001005SANT/Myb domain
PROSITE profilePS5129418.54959109IPR017930Myb domain
PfamPF002496.3E-1361103IPR001005SANT/Myb domain
CDDcd001673.73E-962105No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2462109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
EKDNVKRGQW TPEEDNKLLS YITQHGTRNW RLIPKNAGLQ RCGKSCRLRW TNYLRPDLKH  60
GEFTDAEEQT IIKLHSVVGC RWSVIAAQLP GRTDNDVKNH WNTKLKKKLS GMGIDPVTHK  120
SFSHLMAEIA TTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-3071097108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0342381e-173BT034238.1 Zea mays full-length cDNA clone ZM_BFc0028K07 mRNA, complete cds.
GenBankBT0394221e-173BT039422.1 Zea mays full-length cDNA clone ZM_BFc0012M19 mRNA, complete cds.
GenBankBT0406701e-173BT040670.1 Zea mays full-length cDNA clone ZM_BFc0113I05 mRNA, complete cds.
GenBankBT0432401e-173BT043240.1 Zea mays full-length cDNA clone ZM_BFc0129J22 mRNA, complete cds.
GenBankBT0549881e-173BT054988.1 Zea mays full-length cDNA clone ZM_BFc0168O09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635420.12e-93PREDICTED: transcription factor MYB30
SwissprotQ7XQN12e-95MYB80_ORYSJ; Transcription factor MYB80
TrEMBLW5BY927e-97W5BY92_WHEAT; Uncharacterized protein
STRINGBGIOSGA014912-PA6e-93(Oryza sativa Indica Group)
STRINGLOC_Os04g39470.16e-93(Oryza sativa Japonica Group)
STRINGOB04G23000.13e-93(Oryza brachyantha)
STRINGORGLA04G0126700.15e-93(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108673339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-86myb domain protein 103
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]